PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.003G129100.3
Common NameB456_003G129100
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family G2-like
Protein Properties Length: 351aa    MW: 37601.6 Da    PI: 4.9737
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.003G129100.3genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like955.7e-30171224155
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         +prl+Wtp+LH+rFv++v++L G+++A+Pkti++lm+v+gLt+e+v+SHLQkYRl
  Gorai.003G129100.3 171 RPRLVWTPQLHKRFVDVVAHL-GIKNAVPKTIMQLMNVEGLTRENVASHLQKYRL 224
                         59*******************.********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.061168227IPR017930Myb domain
SuperFamilySSF466891.77E-19168228IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.9E-30170229IPR009057Homeodomain-like
TIGRFAMsTIGR015571.8E-23172224IPR006447Myb domain, plants
PfamPF002496.4E-8174223IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0042753Biological Processpositive regulation of circadian rhythm
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 351 aa     Download sequence    Send to blast
MGEEVTMSEF EVNGGDDEDA AATANTTVVD DEDDVDQRVL EWEIGLPDCD DLTPLSQSLI  60
PPELASAFSI SPEPRPTAHD VNRASQDTLS SLRSGGAHFF TANNNKNKNN NNLRSFNDPM  120
VVEAEGDGSG SGSGSEPKKM RKTDIGIAEE ADSAVRTTEN SEDPSARTLK RPRLVWTPQL  180
HKRFVDVVAH LGIKNAVPKT IMQLMNVEGL TRENVASHLQ KYRLYLKRMQ GLSNEGPSAS  240
DQLFASTPVP QSLHESGSVG CGGGSGVVGG SANGNGHVGM PIPMPYGAPL VPVAMPMYGH  300
MGMHQGGYHH PQNGYEANSY GMQPRDWSGG NKYGSVMSYP NHMAPNDKLN *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A1e-20170229463ARR10-B
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00014PBMTransfer from AT3G46640Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC4713331e-109KC471333.1 Bombax ceiba clone 1 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012471285.10.0PREDICTED: transcription factor LUX-like
SwissprotQ9SNB42e-90PCL1_ARATH; Transcription factor LUX
TrEMBLA0A0D2P0R50.0A0A0D2P0R5_G
TrEMBLA0A0D2QSR00.0A0A0D2QSR0_G
STRINGVIT_06s0004g05120.t011e-124(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G46640.23e-79G2-like family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]